PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_15613
Common NameKK1_016062
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 302aa    MW: 34760.7 Da    PI: 7.9453
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_15613genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-171966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll +++  +G g+W++ a++ g++Rt+k+c++rw++yl
    C.cajan_15613 19 RGPWTLEEDNLLSQYISNHGEGRWNLLAKRSGLKRTGKSCRLRWLNYL 66
                     89********************************************97 PP

2Myb_DNA-binding53.55.4e-1772115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ ++eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
    C.cajan_15613  72 RGNLSPEEQLLILELHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 115
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.1051466IPR017930Myb domain
SuperFamilySSF466892.95E-3017113IPR009057Homeodomain-like
SMARTSM007172.9E-151868IPR001005SANT/Myb domain
PfamPF002492.9E-161966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-232073IPR009057Homeodomain-like
CDDcd001674.07E-112166No hitNo description
PROSITE profilePS5129426.09167121IPR017930Myb domain
SMARTSM007171.8E-1571119IPR001005SANT/Myb domain
PfamPF002497.2E-1672115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-2474120IPR009057Homeodomain-like
CDDcd001679.56E-1276115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MSTSKSVSSS SEDENELRRG PWTLEEDNLL SQYISNHGEG RWNLLAKRSG LKRTGKSCRL  60
RWLNYLKPDV KRGNLSPEEQ LLILELHSKW GNRWSKIAQH LPGRTDNEIK NYWRTRIQKQ  120
ARHLKINSDS REFQELVRRF WIPRLLQKVK ESPSSSTMSI QNQAIPLPQG GVSHSSVGTM  180
PSQTPWQGLC MNEAGPTYSD SDHNNGSCIS FSESANVPNV PQHFGHTINQ FHDFGNFTYD  240
GYHENNNAYE MDTFKTPTAR VAEDVQYPIA DCQMAGANWV NNDFACSMWN MDEFWQFSKL  300
QK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25161214108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX0902520.0JX090252.1 Glycine max ecotype Gwangan Myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235789.10.0MYB transcription factor MYB84
TrEMBLA0A151T3F50.0A0A151T3F5_CAJCA; Transcription factor MYB21
STRINGGLYMA05G35050.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.15e-80myb domain protein 62